General Information

  • ID:  hor002170
  • Uniprot ID:  P67974
  • Protein name:  Insulin A chain
  • Gene name:  INS
  • Organism:  Physeter macrocephalus (Sperm whale) (Physeter catodon)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Physeter (genus), Physeteridae (family), Odontoceti (parvorder), Cetacea (infraorder), Whippomorpha (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GIVEQCCTSICSLYQLENYCN
  • Length:  21(31-51)
  • Propeptide:  FVNQHLCGSHLVEALYLVCGERGFFYTPKAGIVEQCCTSICSLYQLENYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  AF-P67974-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002170_AF2.pdbhor002170_ESM.pdb

Physical Information

Mass: 274064 Formula: C99H155N25O35S4
Absent amino acids: ADFHKMPRW Common amino acids: C
pI: 3.61 Basic residues: 0
Polar residues: 12 Hydrophobic residues: 5
Hydrophobicity: 21.43 Boman Index: -1785
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 88.1
Instability Index: 2254.29 Extinction Coefficient cystines: 3230
Absorbance 280nm: 161.5

Literature

  • PubMed ID:  13373434
  • Title:  Species differences in insulin.
  • PubMed ID:  13552701
  • Title:  Structure of sperm- and sei-whale insulins and their breakdown by whale pepsin.